DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoYb and CG31875

DIOPT Version :9

Sequence 1:NP_001245959.1 Gene:SoYb / 34331 FlyBaseID:FBgn0051755 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster


Alignment Length:123 Identity:31/123 - (25%)
Similarity:46/123 - (37%) Gaps:44/123 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 RSSALKARQLLDILAEQDGSKKRTLIYCKNQMELEELSAILI------------------EAGLQ 763
            |:|.|.:.||.|   :.|.:.:..|.|..:..::||..|:.|                  |....
  Fly    39 RASILWSPQLQD---QDDKAVREYLDYAASLYDIEEEQALFILRRHGYDLPLAHRRLEKTETARG 100

  Fly   764 C----------VDISKAQNQSPNRLMLVDDSQVRKQLPVRNIQLLIHFSLPESWLRFS 811
            |          :.::||..|..     .|.::|||:||        ||.|.|..|.||
  Fly   101 CRYHRWKAEDLIRLTKAFEQYG-----TDFAKVRKELP--------HFPLAELRLYFS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoYbNP_001245959.1 TUDOR 7..115 CDD:278965
SrmB 475..877 CDD:223587 31/123 (25%)
P-loop_NTPase 480..>646 CDD:304359
TUDOR 927..1043 CDD:278965
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0334
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.