DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoYb and mahe

DIOPT Version :9

Sequence 1:NP_001245959.1 Gene:SoYb / 34331 FlyBaseID:FBgn0051755 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster


Alignment Length:669 Identity:124/669 - (18%)
Similarity:229/669 - (34%) Gaps:196/669 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 YQQKNTDSSTLSGPRNLASSSTNSNSNVRKSMTLFKSSGAHLTTSLSVPLTENCTNQSNNRTVVF 400
            ||:.|..:....|.:       ::|.|......|.|...|.:.       .|...|...| .|..
  Fly   140 YQKPNNGAGVAGGYQ-------SNNYNAAALGMLSKEERAEIQ-------REKAKNPGRN-LVKP 189

  Fly   401 SMDKMEQIFNDMLGKNPSERSVQKNRSQMPNSNVSTTKRCVEKMHVCRSENMGDRKPSVCLKHLV 465
            ..:.:|....|....:|:  ::.|:..|     |:..:|.:|                      :
  Fly   190 KWENLEPFLKDFYNIHPN--TLAKSEQQ-----VAEIRRELE----------------------I 225

  Fly   466 LAHSPEPVNPVTSYKELPLGNTILNAMDDLNFQTPLPTQIYAWPHLVNRGSLVLVNPSGTGRSWS 530
            .....|..:||.|::|..|...::..|....|..|...|...||..::...||.:..:|:|::.:
  Fly   226 TVSGNELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLA 290

  Fly   531 YLPVICSSVLSSFENVTSNLDTRIAPGPLAILIVDSVENAKKLASHCEFLMKDFNTQNLKVVNTH 595
            |:       |.:..::.:........||:|:::..:.|.|:::.|               ||..:
  Fly   291 YM-------LPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQS---------------VVRDY 333

  Fly   596 AH---------------SMMDVYMMLLNSCGVLVTTLAHLNNILSNELPLVNPTRLEFIIFDDYD 645
            .|               |.:.....|.....|::.|...|.:.|.|.  ..|..|..:::.|:.|
  Fly   334 GHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLENR--NTNLQRCTYLVLDEAD 396

  Fly   646 RKRLDNA--ELLKEVFQKVNSIGGLSKQLVLVAQQWHSERFQKLLNRTTKPLILFGDFLEAALYG 708
            | .||..  ..::::.:::..    .:|:|:.:..|..|           ...|.||||...:  
  Fly   397 R-MLDMGFEPQIRKIIEQIRP----DRQVVMWSATWPKE-----------VQALAGDFLNDYI-- 443

  Fly   709 GLKFNVTLRSSALKA----RQLLDILAE---------------------QDGSKKRTLIYCKNQM 748
                .:.:.|..|.|    ||:::|..|                     .:|:|  .:::.:.::
  Fly   444 ----QINIGSMNLSANHNIRQIVEICTEIEKPQRLVCLLNEISPIKNSGNNGNK--IIVFVETKI 502

  Fly   749 ELEELSAILIEAGLQCVDI--SKAQNQSPNRL---------MLVDDSQVRKQLPVRNIQLLIHFS 802
            ::|::..|:...|.....|  .|.||:..:.|         :|:......:.|.|.::|.:|::.
  Fly   503 KVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYD 567

  Fly   803 LPESWLRFSRRFHTMADNIRNLFTKPIGRGQDLIT-YILMDENNAKEWPRIMKFLQDHGLT---- 862
            .|.|...:..|...            .||.|.|.| |.....:|||:...::..|::.|.|    
  Fly   568 YPNSSENYVHRIGR------------TGRCQQLGTAYTFFTPDNAKQARELISVLEEAGQTPSQA 620

  Fly   863 ----TQSMPDS--------------------------EQQLDNTLPYCPYKLSNGNCNRNQCNKR 897
                .:|||.|                          :|:.:|.|.|    .:..|.|.|:....
  Fly   621 LLDLARSMPSSGGYRGNKRWNNNSGGDRNTGGNNGIYQQRNNNPLNY----QAGNNYNNNRSGPP 681

  Fly   898 HHFLKTDLPKIGNPLLQPG 916
            ...........||..||.|
  Fly   682 TGSSYQQYAAGGNTYLQNG 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoYbNP_001245959.1 TUDOR 7..115 CDD:278965
SrmB 475..877 CDD:223587 92/489 (19%)
P-loop_NTPase 480..>646 CDD:304359 33/180 (18%)
TUDOR 927..1043 CDD:278965
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 112/619 (18%)
DEADc 239..446 CDD:238167 46/252 (18%)
HELICc 457..594 CDD:238034 28/150 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.