DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoYb and DDX17

DIOPT Version :9

Sequence 1:NP_001245959.1 Gene:SoYb / 34331 FlyBaseID:FBgn0051755 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_001091974.1 Gene:DDX17 / 10521 HGNCID:2740 Length:731 Species:Homo sapiens


Alignment Length:492 Identity:93/492 - (18%)
Similarity:181/492 - (36%) Gaps:97/492 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 NPSERSVQK--NRSQMPNSN----------VSTTKRCVEKMHVCRSENMGDRKPSVCLKHLVLAH 468
            ||.||..:|  :.|::|...          ...|...|:::.  |.:.:..|...||.|      
Human   112 NPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELR--RKKEITVRGGDVCPK------ 168

  Fly   469 SPEPVNPVTSYKELPLGNTILNAMDDLNFQTPLPTQIYAWPHLVNRGSLVLVNPSGTGRSWSYLP 533
                  ||.::........:::.:.|.:|..|.|.|...:|..::...:|.:..:|:|::.:|| 
Human   169 ------PVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYL- 226

  Fly   534 VICSSVLSSFENVTSNLDTRIAPGPLAILIVDSVENAKKLASHCEFLMKDF-NTQNLKVVNTHAH 597
                  |.:..::..........||:.:::..:    ::||...:.:..|: ....||....:..
Human   227 ------LPAIVHINHQPYLERGDGPICLVLAPT----RELAQQVQQVADDYGKCSRLKSTCIYGG 281

  Fly   598 SMMDVYMM-LLNSCGVLVTTLAHLNNILSNELPLVNPTRLEFIIFDDYDRKRLDNAELLKEVFQK 661
            :.....:. |.....:.:.|...|.:.|  |....|..|..:::.|:.|| .||.          
Human   282 APKGPQIRDLERGVEICIATPGRLIDFL--ESGKTNLRRCTYLVLDEADR-MLDM---------- 333

  Fly   662 VNSIGGLSKQLVLVAQQWHSERFQKLLNRTTKP---LILFGDFLEAALYGGLKFNVTLRSSALKA 723
                 |...|:..:..|...:| |.|:...|.|   ..|..|||..  |..:.......|:....
Human   334 -----GFEPQIRKIVDQIRPDR-QTLMWSATWPKEVRQLAEDFLRD--YTQINVGNLELSANHNI 390

  Fly   724 RQLLDILAEQDGSKKRTLIYCKNQMELEELSAILIEAGLQCVDISKAQNQS--PNRLMLVDDSQV 786
            .|::|:..|.:...|...:..:...|.|..:.|.:|...:|.|:::...:.  |...:..|.||.
Human   391 LQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQP 455

  Fly   787 RKQ-----------------------LPVRNIQLLIHFSLPESWLRFSRRFHTMADNIRN----L 824
            .:.                       |.|.:::.:|::..|.|...:..|....|.:...    .
Human   456 ERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYT 520

  Fly   825 FTKP--IGRGQDLITYILMDENNAKEWPRIMKFLQDH 859
            |..|  :.:.::||.  :::|.|....|::|: |.||
Human   521 FFTPGNLKQARELIK--VLEEANQAINPKLMQ-LVDH 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoYbNP_001245959.1 TUDOR 7..115 CDD:278965
SrmB 475..877 CDD:223587 79/421 (19%)
P-loop_NTPase 480..>646 CDD:304359 27/167 (16%)
TUDOR 927..1043 CDD:278965
DDX17NP_001091974.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..115 2/2 (100%)
Q motif 171..199 4/27 (15%)
DEADc 173..378 CDD:238167 44/236 (19%)
DEXDc 191..393 CDD:214692 44/233 (19%)
DEAD box 325..328 1/2 (50%)
HELICc 389..521 CDD:238034 21/131 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 661..731
Interaction with YAP1. /evidence=ECO:0000269|PubMed:24581491 720..728
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.