DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and AQY1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_015518.1 Gene:AQY1 / 856322 SGDID:S000006396 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:61/226 - (26%)
Similarity:103/226 - (45%) Gaps:27/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ISECLASFMYV---FIVCGAA----AGVGV-GASVSSVLLATALASGLAMATLTQCFLHISGAHI 125
            :.|...:||::   :::|..|    |.|.. ..|....|:..|:..|.::.....||..:||..:
Yeast    53 VGEFCGTFMFLWCAYVICNVANHDVALVAAPDGSHPGQLIMIAIGFGFSVMFSIWCFAGVSGGAL 117

  Fly   126 NPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPG---YQGNLQAAISHSAALAAW 187
            |||::|:||:.|::||.|..:...:|...|:|.......:| ||   :..:|....|.:..|.. 
Yeast   118 NPAMSLSLCLARAVSPTRCVVMWVSQIVAGMAAGGAASAMT-PGEVLFANSLGLGCSRTRGLFL- 180

  Fly   188 ERFGVEFILTFLVVLCYFVSTDPMKKFMGNSAA------SIGCAYSACCFVSMPYLNPARSLGPS 246
            |.||.       .:||..|....::|...|..|      |:..|:.|....:...:|||||||.:
Yeast   181 EMFGT-------AILCLTVLMTAVEKRETNFMAALPIGISLFIAHVALTAYTGTGVNPARSLGAA 238

  Fly   247 FVLNKWDS-HWVYWFGPLVGGMASGLVYEYI 276
            .....:.. ||:||.|.|:|.:.:..|::.:
Yeast   239 VAARYFPHYHWIYWIGTLLGSILAWSVWQLL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 60/221 (27%)
AQY1NP_015518.1 MIP 54..266 CDD:273306 60/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9195
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.