DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and YLL053C

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_013047.1 Gene:YLL053C / 850673 SGDID:S000003976 Length:152 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:39/139 - (28%)
Similarity:54/139 - (38%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 ITAQCGGGIAGAALLYGVTVPG---YQGNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTD 209
            |.....||.|.|      ..||   :...|....|.|..|.. |.||.       .|||..|...
Yeast     7 IAGMAAGGAASA------MTPGKVLFTNALGLGCSRSRGLFL-EMFGT-------AVLCLTVLMT 57

  Fly   210 PMKKFMGNSAA------SIGCAYSACCFVSMPYLNPARSLGPSFVLNKWDS-HWVYWFGPLVGGM 267
            .::|...|..|      |:..|:.|....:...:|||||||.:.....:.. ||:||..||:|..
Yeast    58 AVEKRETNFMAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLGAF 122

  Fly   268 ASGLVYEYI 276
            .:..|::.:
Yeast   123 LAWSVWQLL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 38/134 (28%)
YLL053CNP_013047.1 MIP <1..133 CDD:412216 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9195
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.