DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and TIP3;1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_177462.1 Gene:TIP3;1 / 843653 AraportID:AT1G73190 Length:268 Species:Arabidopsis thaliana


Alignment Length:226 Identity:72/226 - (31%)
Similarity:110/226 - (48%) Gaps:19/226 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAGVG---------VGASVSSVLLATALASGLAMATLTQCFLHIS 121
            |:.::|.|::|::||...|:...:.         .|.:....|:..|||...|:.......:::|
plant    24 RATLAEFLSTFVFVFAAEGSILSLDKLYWEHAAHAGTNTPGGLILVALAHAFALFAAVSAAINVS 88

  Fly   122 GAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAALAA 186
            |.|:|||||....|...::.|||..|..||..|.|. |.||..:|..|.:   ......::.:.|
plant    89 GGHVNPAVTFGALVGGRVTAIRAIYYWIAQLLGAIL-ACLLLRLTTNGMR---PVGFRLASGVGA 149

  Fly   187 WERFGVEFILTF-LVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY----LNPARSLGP 245
            .....:|.|||| ||.:.|....||.:..:|..| .:||....|...|..|:    :||||:.||
plant   150 VNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLAIGLIVGANILVGGPFSGASMNPARAFGP 214

  Fly   246 SFVLNKWDSHWVYWFGPLVGGMASGLVYEYI 276
            :.|..:|..||:||.||.:|...:.|:|||:
plant   215 ALVGWRWHDHWIYWVGPFIGSALAALIYEYM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 69/221 (31%)
TIP3;1NP_177462.1 MIP 11..268 CDD:412216 72/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.