DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and AT1G52180

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_175629.1 Gene:AT1G52180 / 841648 AraportID:AT1G52180 Length:124 Species:Arabidopsis thaliana


Alignment Length:84 Identity:24/84 - (28%)
Similarity:37/84 - (44%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 HSAA--LAAWERFGVEFILTF-LVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY---- 236
            ||.|  :.:.:|..:|.|:|| ||...|..:.|.....:|..| .:|.....|....:.|:    
plant    41 HSVAVRVGSTQRVVMEIIITFALVYTVYATAIDSNNGTLGTIAPLAIRLIVGANILAAGPFSGGP 105

  Fly   237 LNPARSLGPSFVLNKWDSH 255
            :||.||.|.|..:..:..|
plant   106 MNPGRSFGSSLAVGNFSGH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 24/84 (29%)
AT1G52180NP_175629.1 MIP <29..122 CDD:294134 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.