DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and AT1G52180

DIOPT Version :10

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_175629.1 Gene:AT1G52180 / 841648 AraportID:AT1G52180 Length:124 Species:Arabidopsis thaliana


Alignment Length:84 Identity:24/84 - (28%)
Similarity:37/84 - (44%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 HSAA--LAAWERFGVEFILTF-LVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY---- 236
            ||.|  :.:.:|..:|.|:|| ||...|..:.|.....:|..| .:|.....|....:.|:    
plant    41 HSVAVRVGSTQRVVMEIIITFALVYTVYATAIDSNNGTLGTIAPLAIRLIVGANILAAGPFSGGP 105

  Fly   237 LNPARSLGPSFVLNKWDSH 255
            :||.||.|.|..:..:..|
plant   106 MNPGRSFGSSLAVGNFSGH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:395174 24/84 (29%)
AT1G52180NP_175629.1 MIP <29..122 CDD:444743 23/80 (29%)

Return to query results.
Submit another query.