DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and NIP3;1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_174472.2 Gene:NIP3;1 / 840079 AraportID:AT1G31885 Length:323 Species:Arabidopsis thaliana


Alignment Length:282 Identity:77/282 - (27%)
Similarity:128/282 - (45%) Gaps:32/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VNNRLSSTLQAPKRSMQAEIRTLEFWRSIISECLASFMYVFIVCGA-AAGVGVGASVSSVLLATA 103
            :::..||.|.||       :.::.|.:.:|.|.:.:|..:|..|.| ......|..|:  |...|
plant    24 IDDSRSSDLSAP-------LVSVSFVQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVT--LPGIA 79

  Fly   104 LASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGV--- 165
            |..||.:..:.....|:||||.||||::|....:.....:...||.||..|....||:|..|   
plant    80 LVWGLVVTVMIYSIGHVSGAHFNPAVSIAFASSKKFPFNQVPGYIAAQLLGSTLAAAVLRLVFHL 144

  Fly   166 --TVPGYQGNLQAAI--SHSAALAAWERFGVEFILTF-LVVLCYFVSTDPMKKFMGNSAA-SIGC 224
              .|...:|::....  |:|...:    |.:|||.|| |:.:...|:||  |:..|:.|. :||.
plant   145 DDDVCSLKGDVYVGTYPSNSNTTS----FVMEFIATFNLMFVISAVATD--KRATGSFAGIAIGA 203

  Fly   225 AYSACCFVSMPY----LNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSR---NR 282
            ........|.|.    :||||||||:.:...:...|:|...|::|.::....|..:.:::   :.
plant   204 TIVLDILFSGPISGASMNPARSLGPALIWGCYKDLWLYIVSPVIGALSGAWTYGLLRSTKKSYSE 268

  Fly   283 NLRHNKGSIDNDSSSIHSEDEL 304
            .:|.|...:.:......|:||:
plant   269 IIRPNCNKVSSRDRQEASQDEI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 66/228 (29%)
NIP3;1NP_174472.2 MIP 37..271 CDD:294134 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.