DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and BETA-TIP

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_173223.1 Gene:BETA-TIP / 838359 AraportID:AT1G17810 Length:267 Species:Arabidopsis thaliana


Alignment Length:248 Identity:82/248 - (33%)
Similarity:120/248 - (48%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAGVG---------------VGASVSSVLLATALASGLAMATLTQ 115
            |:.::|.|::|::||      ||.|               .|.:....|:..|||..||:.....
plant    24 RATLAEFLSTFVFVF------AGEGSILALDKLYWDTAAHTGTNTPGGLVLVALAHALALFAAVS 82

  Fly   116 CFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALL----YGVTVPGYQGNLQA 176
            ..:::||.|:|||||.|..:...||.|||..|..||..|.|....||    .|:...|:  ::.:
plant    83 AAINVSGGHVNPAVTFAALIGGRISVIRAIYYWVAQLIGAILACLLLRLATNGLRPVGF--HVAS 145

  Fly   177 AISHSAALAAWERFGVEFILTF-LVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY--- 236
            .:|....|.      :|.|||| ||.:.|..:.||.:..:|..| .:||....|...|..|:   
plant   146 GVSELHGLL------MEIILTFALVYVVYSTAIDPKRGSIGIIAPLAIGLIVGANILVGGPFDGA 204

  Fly   237 -LNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEY-IFNSRNRNLRHN 287
             :||||:.||:.|..:|.:||:||.||.:||..:.|:||| |..|.|....|:
plant   205 SMNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIYEYMIIPSVNEPPHHS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 75/231 (32%)
BETA-TIPNP_173223.1 MIP 11..267 CDD:412216 82/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.