DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and PIP2;4

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_200874.1 Gene:PIP2;4 / 836187 AraportID:AT5G60660 Length:291 Species:Arabidopsis thaliana


Alignment Length:262 Identity:81/262 - (30%)
Similarity:120/262 - (45%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APKRSMQAEIRTLEFWRSIISECLAS--FMYVFIVC---------GAAAGV---GVGASVSSVLL 100
            ||...|: |:|....:|::|:|.:|:  |:||.|:.         ..|.||   |||      :|
plant    24 APFFDME-ELRKWPLYRAVIAEFVATLLFLYVSILTVIGYKAQTDATAGGVDCGGVG------IL 81

  Fly   101 ATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALL--- 162
            ..|.|.|..:..|..|...|||.|||||||:.|.:.|.:|.:|..:||.|||.|.|.|...:   
plant    82 GIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAF 146

  Fly   163 ---YGVTVPGYQGNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGN-----SA 219
               |.....|....|....:....|      |.|.|.||::|...|.:|||.:....:     :.
plant   147 QSSYYTRYGGGANELADGYNKGTGL------GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAP 205

  Fly   220 ASIGCAYSACCFVSMPY----LNPARSLGPSFVLNK---WDSHWVYWFGPLVGGMASGLVYEYIF 277
            ..||.|.......::|.    :|||||.|.:.:.|.   ||..|::|.||::|..|:...:::|.
plant   206 LPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFIL 270

  Fly   278 NS 279
            .:
plant   271 RA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 77/246 (31%)
PIP2;4NP_200874.1 MIP 31..266 CDD:395174 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.