DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and TIP2;3

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_199556.1 Gene:TIP2;3 / 834794 AraportID:AT5G47450 Length:250 Species:Arabidopsis thaliana


Alignment Length:224 Identity:80/224 - (35%)
Similarity:114/224 - (50%) Gaps:18/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAG----VGVGASVSSVLLATALASGLAMATLTQCFLHISGAHIN 126
            ::.:||.:|:.::||...|:|..    ...||...:.|:|.|:|...|:........:|||.|:|
plant    19 KAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISGGHLN 83

  Fly   127 PAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISH--SAALAAWER 189
            |||||.|.:..:|:.|....|..|||.|.|....||..||      |.::..:|  ||.|.|.|.
plant    84 PAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLVFVT------NGKSVPTHGVSAGLGAVEG 142

  Fly   190 FGVEFILTF-LVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY----LNPARSLGPSFV 248
            ..:|.::|| ||...|..:.||.|..:|..| .:||....|....:.|:    :|||||.||:.|
plant   143 VVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVV 207

  Fly   249 LNKWDSHWVYWFGPLVGGMASGLVYEYIF 277
            .......|:||.||||||..:||:|..:|
plant   208 SGDLSQIWIYWVGPLVGGALAGLIYGDVF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 78/218 (36%)
TIP2;3NP_199556.1 PLN00166 1..250 CDD:165733 80/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.