DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and NIP4;2

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001330234.1 Gene:NIP4;2 / 833760 AraportID:AT5G37820 Length:319 Species:Arabidopsis thaliana


Alignment Length:221 Identity:67/221 - (30%)
Similarity:105/221 - (47%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCG-AAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPAV 129
            :.:|:|.:.::..:|..|| ....|..|.:::  .....:..||.:..:.....||||||.||||
plant    79 QKLIAEMIGTYFIIFSGCGVVVVNVLYGGTIT--FPGICVTWGLIVMVMIYSTGHISGAHFNPAV 141

  Fly   130 TLALCVVRSISPIRAAMYITAQCGGGIAGA---ALLYGVTVPGYQGNLQAAISHSAALAAWERFG 191
            |:...|.|.....:..:||.||..|.:..:   .|::.||...:.|......|..|.:|      
plant   142 TVTFAVFRRFPWYQVPLYIGAQLTGSLLASLTLRLMFNVTPKAFFGTTPTDSSGQALVA------ 200

  Fly   192 VEFILTFLVVLCYF-VSTDPMKKFMGNSAA-SIGCAYSACCFVSMPY----LNPARSLGPSFVLN 250
             |.|::||::.... |:||  .:..|..|. ::|.......||:.|.    :||||||||:.|:.
plant   201 -EIIISFLLMFVISGVATD--SRATGELAGIAVGMTIILNVFVAGPISGASMNPARSLGPAIVMG 262

  Fly   251 KWDSHWVYWFGPLVGGMASGLVYEYI 276
            ::...|||..||.||..|.|.||.::
plant   263 RYKGIWVYIVGPFVGIFAGGFVYNFM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 65/216 (30%)
NIP4;2NP_001330234.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.