DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and PIP3

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001190920.1 Gene:PIP3 / 829662 AraportID:AT4G35100 Length:280 Species:Arabidopsis thaliana


Alignment Length:256 Identity:78/256 - (30%)
Similarity:119/256 - (46%) Gaps:39/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APKRSMQAEIRTLEFWRSIISECLASFMYVFIVCGAAAG--------VGVGASVSSVLLATALAS 106
            ||...| .|:::..|:|::|:|.:|:.:::::......|        .|||      ||..|.|.
plant    23 APLLDM-GELKSWSFYRALIAEFIATLLFLYVTVATVIGHKKQTGPCDGVG------LLGIAWAF 80

  Fly   107 GLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGV------ 165
            |..:..|..|...|||.|||||||..|.:.|.:|.:||..|:.|||.|.|.|...:...      
plant    81 GGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYN 145

  Fly   166 TVPGYQGNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGN-----SAASIGCA 225
            |:.|....:....|...||      |.|.|.||::|...|.:|||.:....:     :...||.|
plant   146 TLGGGANTVADGYSKGTAL------GAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFA 204

  Fly   226 YSACCFVSMPY----LNPARSLGPSFVLNK---WDSHWVYWFGPLVGGMASGLVYEYIFNS 279
            .......::|.    :|||||.|.:.:.|.   ||..|::|.||.:|.:|:...::||..:
plant   205 VFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 73/240 (30%)
PIP3NP_001190920.1 MIP 30..259 CDD:395174 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.