DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and PIP1;4

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_567178.1 Gene:PIP1;4 / 827956 AraportID:AT4G00430 Length:287 Species:Arabidopsis thaliana


Alignment Length:240 Identity:76/240 - (31%)
Similarity:117/240 - (48%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFI----VCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFL 118
            |:.:..|:|:.|:|.:|:|::::|    |.|......:.|||.  :...|.|.|..:..|..|..
plant    45 ELSSWSFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVG--IQGIAWAFGGMIFALVYCTA 107

  Fly   119 HISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQ--GNLQAAISHS 181
            .|||.|||||||..|.:.|.:|..||..|:..||.|.|.||.::.|.....||  |.....::|.
plant   108 GISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAHG 172

  Fly   182 AALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGN-----SAASIGCAYSACCFVSMPY----L 237
            ....:  ..|.|.|.||::|...|.:||..:....:     :...||.|.......::|.    :
plant   173 YTKGS--GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGI 235

  Fly   238 NPARSLGPSFVLNK---WDSHWVYWFGPLVGGMASGLVYEYIFNS 279
            |||||||.:.:.||   ||.||::|.||.:|...:.|.::.:..:
plant   236 NPARSLGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIRA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 76/232 (33%)
PIP1;4NP_567178.1 MIP 45..274 CDD:395174 76/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.