DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and TIP2;2

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_193465.1 Gene:TIP2;2 / 827446 AraportID:AT4G17340 Length:250 Species:Arabidopsis thaliana


Alignment Length:230 Identity:80/230 - (34%)
Similarity:116/230 - (50%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAGVGVGASVSSV----------LLATALASGLAMATLTQCFLHI 120
            ::.:||.:|:.::||      ||||...:.:.:          |:|.|:|...|:........:|
plant    19 KAYLSEFIATLLFVF------AGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGVSIAANI 77

  Fly   121 SGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISH--SAA 183
            ||.|:||||||.|.|..:|:.|....|..|||.|.|....||..||      |.::..:|  :|.
plant    78 SGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLVFVT------NGESVPTHGVAAG 136

  Fly   184 LAAWERFGVEFILTF-LVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY----LNPARS 242
            |.|.|...:|.::|| ||...|..:.||.|..:|..| .:||....|....:.|:    :|||||
plant   137 LGAIEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARS 201

  Fly   243 LGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIF 277
            .||:.|...:...|:||.||||||..:||:|..:|
plant   202 FGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 78/224 (35%)
TIP2;2NP_193465.1 PLN00166 1..250 CDD:165733 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.