DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and PIP1A

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001078323.1 Gene:PIP1A / 825316 AraportID:AT3G61430 Length:286 Species:Arabidopsis thaliana


Alignment Length:290 Identity:88/290 - (30%)
Similarity:133/290 - (45%) Gaps:38/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LEAMRKDSHGGGHGVNNR--LSSTLQAPKRSMQ---------AEIRTLEFWRSIISECLASFMYV 79
            :|...:|...|.:....|  :.::.|:.|...:         .|:.:..|||:.|:|.:|:|:::
plant     1 MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPFFEPGELSSWSFWRAGIAEFIATFLFL 65

  Fly    80 FI----VCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSIS 140
            :|    |.|......:.|||.  :...|.|.|..:..|..|...|||.|||||||..|.:.|.:|
plant    66 YITVLTVMGVKRSPNMCASVG--IQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLS 128

  Fly   141 PIRAAMYITAQCGGGIAGAALLYGVTVPGYQ--GNLQAAISHSAALAAWERFGVEFILTFLVVLC 203
            ..||..||..||.|.|.||.::.|.....||  |.....::|.....:  ..|.|.|.||::|..
plant   129 LTRALYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGS--GLGAEIIGTFVLVYT 191

  Fly   204 YFVSTDPMKKFMGN-----SAASIGCAYSACCFVSMPY----LNPARSLGPSFVLNK---WDSHW 256
            .|.:||..:....:     :...||.|.......::|.    :|||||||.:.:.||   ||.||
plant   192 VFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHSWDDHW 256

  Fly   257 VYWFGPLVGGMASGLVYEYI-----FNSRN 281
            |:|.||.:|...:.|.:..:     |.||:
plant   257 VFWVGPFIGAALAALYHVVVIRAIPFKSRS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 79/232 (34%)
PIP1ANP_001078323.1 MIP 44..273 CDD:395174 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.