DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and PIP2;5

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_191042.1 Gene:PIP2;5 / 824647 AraportID:AT3G54820 Length:286 Species:Arabidopsis thaliana


Alignment Length:254 Identity:76/254 - (29%)
Similarity:116/254 - (45%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFIVCGAAAG--------------VGVGASVSSVLLATALASGL 108
            |:....|:|::|:|.:|:.:::::......|              .|||      :|..|.|.|.
plant    30 ELGKWSFYRALIAEFIATLLFLYVTIMTVIGYKSQTDPALNPDQCTGVG------VLGIAWAFGG 88

  Fly   109 AMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALL------YGVTV 167
            .:..|..|...|||.|||||||..|.:.|.::.:||.||:.|||.|.|.|.||:      |....
plant    89 MIFILVYCTAGISGGHINPAVTFGLLLARKVTLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRY 153

  Fly   168 PGYQGNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGN-----SAASIGCAYS 227
            .|....|....|....:||      |.|.||::|...|.:|||.:....:     :...||.|..
plant   154 GGGANGLSDGYSIGTGVAA------EIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVF 212

  Fly   228 ACCFVSMPY----LNPARSLGPSFVLNK---WDSHWVYWFGPLVGGMASGLVYEYIFNS 279
            .....::|.    :|||||||.:.:.||   ||.||::|.||..|...:...::::..:
plant   213 IVHLATIPITGTGINPARSLGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 76/246 (31%)
PIP2;5NP_191042.1 MIP 30..265 CDD:395174 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.