DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and TIP5;1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_190328.1 Gene:TIP5;1 / 823898 AraportID:AT3G47440 Length:256 Species:Arabidopsis thaliana


Alignment Length:260 Identity:70/260 - (26%)
Similarity:116/260 - (44%) Gaps:53/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAGVGVGASVSS------------VLLATALASGLAMATLTQCFL 118
            |..:||.:::|.:|.        ..||:.:||            .:|..|:|:.||:::......
plant    23 RCYVSEFISTFFFVL--------AAVGSVMSSRKLMAGDVSGPFGVLIPAIANALALSSSVYISW 79

  Fly   119 HISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVT-----VPGYQ--GNLQA 176
            ::||.|:|||||.|:.|...||...|..|.|:|....:. |.|:..||     ||.|:  |.:..
plant    80 NVSGGHVNPAVTFAMAVAGRISVPTAMFYWTSQMIASVM-ACLVLKVTVMEQHVPIYKIAGEMTG 143

  Fly   177 AISHSAALAAWERFG---VEFILTFLVVLCYFVSTDPMKKF-MGNSAASIGCAYSACCFVSMPY- 236
                         ||   :|.:|.|::|...|.::||.:.. :......||....|....:.|: 
plant   144 -------------FGASVLEGVLAFVLVYTVFTASDPRRGLPLAVGPIFIGFVAGANVLAAGPFS 195

  Fly   237 ---LNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSIDNDSSSI 298
               :|||.:.|.:.|...:.:..|||.|||:||..:.|||:.:...    :..::||...|:..:
plant   196 GGSMNPACAFGSAMVYGSFKNQAVYWVGPLLGGATAALVYDNVVVP----VEDDRGSSTGDAIGV 256

  Fly   299  298
            plant   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 65/233 (28%)
TIP5;1NP_190328.1 PLN00167 1..256 CDD:215085 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.