DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and TIP2

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_189283.1 Gene:TIP2 / 822259 AraportID:AT3G26520 Length:253 Species:Arabidopsis thaliana


Alignment Length:249 Identity:76/249 - (30%)
Similarity:121/249 - (48%) Gaps:38/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGV------GASVSSVLLATALASGLAMATL 113
            :|.|:......|:.::|.:::.::||  .|:.:|:..      ||:..|.|:|.|||....:...
plant    11 VQEEVYHPNALRAALAEFISTLIFVF--AGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVA 73

  Fly   114 TQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLY----GVTVPGYQGNL 174
            .....:|||.|:|||||..:.:..:|:.:|..:|..||..|.:|...||.    |..:|.:  .|
plant    74 VSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAF--GL 136

  Fly   175 QAAISHSAALAAWERFGVEFILTF-LVVLCYFVSTDPMKKFMGNSA---------ASI--GCAYS 227
            .|.:....||.      .|.::|| ||...|..:.||....:|..|         |:|  |.|:|
plant   137 SAGVGSLNALV------FEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFS 195

  Fly   228 ACCFVSMPYLNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRN 281
            ...      :|||.:.||:.|...|.:|||||.|||:||..:|::|:::|...|
plant   196 GAS------MNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDEN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 72/236 (31%)
TIP2NP_189283.1 PLN00027 1..253 CDD:177664 76/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.