DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and PIP1B

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001078067.1 Gene:PIP1B / 819204 AraportID:AT2G45960 Length:301 Species:Arabidopsis thaliana


Alignment Length:270 Identity:81/270 - (30%)
Similarity:121/270 - (44%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LEAMRKDSHGGGHGVNNR--LSSTLQAPKRSMQ---------AEIRTLEFWRSIISECLASFMYV 79
            :|...:|...|.:....|  :.::.|:.|...:         .|:.:..|||:.|:|.:|:|:::
plant     1 MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIATFLFL 65

  Fly    80 FI----VCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSIS 140
            :|    |.|......:.|||.  :...|.|.|..:..|..|...|||.|||||||..|.:.|.:|
plant    66 YITVLTVMGVKRSPNMCASVG--IQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLS 128

  Fly   141 PIRAAMYITAQCGGGIAGAALLYGVTVPGYQ--GNLQAAISHSAALAAWERFGVEFILTFLVVLC 203
            ..||..||..||.|.|.||.::.|.....||  |.....|:|.....:  ..|.|.|.||::|..
plant   129 LTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGS--GLGAEIIGTFVLVYT 191

  Fly   204 YFVSTDPMKKFMGN-----SAASIGCAYSACCFVSMPY----LNPARSLGPSFVLNK---WDSH- 255
            .|.:||..:....:     :...||.|.......::|.    :|||||||.:.:.||   ||.| 
plant   192 VFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDNAWDDHV 256

  Fly   256 -----W-VYW 259
                 | ::|
plant   257 MGLLGWTIHW 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 75/227 (33%)
PIP1BNP_001078067.1 MIP 44..261 CDD:278651 73/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.