DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and PIP2B

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001323849.1 Gene:PIP2B / 818293 AraportID:AT2G37170 Length:328 Species:Arabidopsis thaliana


Alignment Length:258 Identity:79/258 - (30%)
Similarity:119/258 - (46%) Gaps:52/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFI----VCG-------AAAGV---GVGASVSSVLLATALASGL 108
            |:.....:|::|:|.:|:.::::|    |.|       .|.||   |||      :|..|.|.|.
plant    72 ELTKWSLYRAVIAEFVATLLFLYITVLTVIGYKIQSDTKAGGVDCGGVG------ILGIAWAFGG 130

  Fly   109 AMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALL----------Y 163
            .:..|..|...|||.|||||||..|.:.|.:|.|||.:|:.|||.|.|.|...:          |
plant   131 MIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRY 195

  Fly   164 GVTVPGYQGNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGN-----SAASIG 223
            |    |...:|....:....|||      |.|.||::|...|.:|||.:....:     :...||
plant   196 G----GGANSLADGYNTGTGLAA------EIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIG 250

  Fly   224 CAYSACCFVSMPY----LNPARSLGPSFVLNK---WDSHWVYWFGPLVGGMASGLVYEYIFNS 279
            .|.......::|.    :|||||.|.:.:.||   ||.||::|.||.:|...:...::::..:
plant   251 FAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 79/250 (32%)
PIP2BNP_001323849.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.