DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and GAMMA-TIP

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_181221.1 Gene:GAMMA-TIP / 818255 AraportID:AT2G36830 Length:251 Species:Arabidopsis thaliana


Alignment Length:241 Identity:77/241 - (31%)
Similarity:113/241 - (46%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ISECLASFM--YVFIVCGAAAGVGV------GASVSSVLLATALASGLAMATLTQCFLHISGAHI 125
            :...||.|:  .:|:|.|:.:|:..      ||:..|.|:|.|:|....:........:|||.|:
plant    20 LKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVAVSVGANISGGHV 84

  Fly   126 NPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLY----GVTVPGYQGNLQAAISHSAALAA 186
            |||||....:..:|:.:|..:|..||..|.:....:|.    |:.||        |...||.:..
plant    85 NPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVP--------AFGLSAGVGV 141

  Fly   187 WERFGVEFILTF-LVVLCYFVSTDPMKKFMGNSA---------ASI--GCAYSACCFVSMPYLNP 239
            ...|..|.::|| ||...|..:.||....:|..|         |:|  |.|:|...      :||
plant   142 LNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGAS------MNP 200

  Fly   240 ARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIF-NSRNRNL 284
            |.:.||:.|...|.:|||||.||||||..:||:||..| |:.:..|
plant   201 AVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 72/227 (32%)
GAMMA-TIPNP_181221.1 PLN00027 1..251 CDD:177664 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.