DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and NIP2;1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_180986.1 Gene:NIP2;1 / 818002 AraportID:AT2G34390 Length:288 Species:Arabidopsis thaliana


Alignment Length:277 Identity:68/277 - (24%)
Similarity:132/277 - (47%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AMRKDSHGGGHGVNNRLSS----TLQAPK-RSMQAEIRTLEFWRSIISECLASFMYVFIVCGAAA 87
            ::.|.:||....:|.:.||    :|.:.| .|....:.::.|.:.:::|.:.::..:|..|   |
plant     5 SVSKSNHGNVVVLNIKASSLADTSLPSNKHESSSPPLLSVHFLQKLLAELVGTYYLIFAGC---A 66

  Fly    88 GVGVGASVSSV--LLATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITA 150
            .:.|.|..:.|  |:..|:..|:.:..|..|..|:| ||.||||||||...:.....:...|||.
plant    67 AIAVNAQHNHVVTLVGIAVVWGIVIMVLVYCLGHLS-AHFNPAVTLALASSQRFPLNQVPAYITV 130

  Fly   151 QCGGGIAGAA---LLYGVTVPGYQGNLQAAISHSAALAAWERFGVEFILT--FLVVLCYFV---- 206
            |..|....:|   ||:.:............:..|.:.:..:.|.:|||:|  .::|:|...    
plant   131 QVIGSTLASATLRLLFDLNNDVCSKKHDVFLGSSPSGSDLQAFVMEFIITGFLMLVVCAVTTTKR 195

  Fly   207 STDPMKKFMGNSAASIGCAYSACCFVSMPYLNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGL 271
            :|:.::..:..:..::...::.  .||...:|||||:||:.|...:...|:|...|.:|.::..|
plant   196 TTEELEGLIIGATVTLNVIFAG--EVSGASMNPARSIGPALVWGCYKGIWIYLLAPTLGAVSGAL 258

  Fly   272 VYEYIFNSRNRNLRHNK 288
            :::.:.:.:|.....:|
plant   259 IHKMLPSIQNAEPEFSK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 57/225 (25%)
NIP2;1NP_180986.1 MIP 6..283 CDD:412216 68/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.