DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and PIP2;8

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_179277.1 Gene:PIP2;8 / 816186 AraportID:AT2G16850 Length:278 Species:Arabidopsis thaliana


Alignment Length:278 Identity:89/278 - (32%)
Similarity:129/278 - (46%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MRKD-SHGGGHGVNNRLSSTLQAPKRSMQAEIRTLEFWRSIISECLASFMYVFIV---------- 82
            |.|: |..|.||.:  ......||...| ||::...|:|:||:|.:|:.:::::.          
plant     1 MSKEVSEEGRHGKD--YVDPPPAPLLDM-AELKLWSFYRAIIAEFIATLLFLYVTVATVIGHKNQ 62

  Fly    83 CGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMY 147
            .|...|||        ||..|.|.|..:..|..|...|||.|||||||..|.:.|.:|..||..|
plant    63 TGPCGGVG--------LLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVAY 119

  Fly   148 ITAQCGGGIAGAALLYGVTVPGYQ----GNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVST 208
            :.|||.|.|.|..|:....:..|:    |....|..:|...|    .|.|.|.||::|...|.:|
plant   120 MVAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADGYSTGTA----LGAEIIGTFVLVYTVFSAT 180

  Fly   209 DPMKKFMGN-----SAASIGCAYSACCFVSMPY----LNPARSLGPSFVLNK---WDSHWVYWFG 261
            ||.:....:     :...||.|.......::|.    :|||||.|.:.:.|.   ||.||::|.|
plant   181 DPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVG 245

  Fly   262 PLVGGMASGLVYEYIFNS 279
            |.||.:|:...::||..:
plant   246 PFVGALAAAAYHQYILRA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 77/240 (32%)
PIP2;8NP_179277.1 MIP 28..257 CDD:395174 77/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.