DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp3

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_113891.2 Gene:Aqp3 / 65133 RGDID:68428 Length:292 Species:Rattus norvegicus


Alignment Length:266 Identity:70/266 - (26%)
Similarity:106/266 - (39%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPAVT 130
            |..::|||.:.:.|...||:.|.|.:........|...||.|.|:.........:||||:|||||
  Rat    23 RQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLAILVAGQVSGAHLNPAVT 87

  Fly   131 LALCVVRSISPIRAAMYITAQCGGGIAGAALLYGV---TVPGYQGNLQAAIS------------H 180
            .|:|.:.....|:..:|..||..|...||.:::|:   .:..:.|| :..:|            .
  Rat    88 FAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWAFAGN-ELVVSGPNGTAGIFATYP 151

  Fly   181 SAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFM--GNSAASIGCAY----SACCFVSMPYLNP 239
            |..|.....|..:||.|..:::|.....||....:  |..|.::|...    ::..|.|...:||
  Rat   152 SGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNP 216

  Fly   240 ARSLGPSF--VLNKWDSH---------WVYWFGPLVGGMASGLVYEYIF-----------NSRNR 282
            ||..||..  .|..|.|.         ||....||:|.:....||:.:.           .:.|.
  Rat   217 ARDFGPRLFTALAGWGSEVFTTGQNWWWVPIVSPLLGSIGGVFVYQLMIGCHLEQPLPSTEAENV 281

  Fly   283 NLRHNK 288
            .|.|.|
  Rat   282 KLAHMK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 64/238 (27%)
Aqp3NP_113891.2 MIP 23..264 CDD:238204 66/241 (27%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.