powered by:
Protein Alignment bib and MINDY4B
DIOPT Version :9
Sequence 1: | NP_001260313.1 |
Gene: | bib / 34330 |
FlyBaseID: | FBgn0000180 |
Length: | 737 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001338210.2 |
Gene: | MINDY4B / 646951 |
HGNCID: | 35475 |
Length: | 460 |
Species: | Homo sapiens |
Alignment Length: | 74 |
Identity: | 16/74 - (21%) |
Similarity: | 31/74 - (41%) |
Gaps: | 10/74 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 317 QQSQGTYPRGQSNGNGGG--QAAGNGQHQAANMGQMPG-VVANAGQGNYCQNLYTAPPLSSKYDQ 378
|..:|.:.....|.:|.| |..|.|...::.:..:|. .:.::..|.:..:|..|..|
Human 47 QNHEGNHTSADENEDGTGLSQPKGQGHLPSSGLCSIPNPSIISSKLGGFPISLAMATKL------ 105
Fly 379 QQEPLYGGT 387
::.|:|.|
Human 106 -RQILFGNT 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2356 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.