DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp9a

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001028268.1 Gene:aqp9a / 606660 ZFINID:ZDB-GENE-050809-119 Length:294 Species:Danio rerio


Alignment Length:299 Identity:69/299 - (23%)
Similarity:118/299 - (39%) Gaps:67/299 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 WRSIISECLASFMYVFIVCGAAAGVGVGASV--SSVLLATALASGLAMATLTQCFLHISGAHINP 127
            ::..::|.|.:|:.|...||:.|...:..:.  ..:.:....::||.|......  .:||.|:||
Zfish    12 FKEFLAEFLGTFVLVLFGCGSVAQTVLSRNTLGEPLTIHIGFSTGLMMGVYVSG--GVSGGHLNP 74

  Fly   128 AVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAIS------------- 179
            ||:||:.::..:...:..:|:.||..|..||||.::|:....:.......:|             
Zfish    75 AVSLAMVILGKLKIWKFPVYVIAQMLGAFAGAAAVFGLYYDAFMEFTSGILSVTGINATGHIFSS 139

  Fly   180 ----HSAALAAWERFGVEFILTFLVVLCYFVSTD-----------PMK---KFMGNSAA-SIGCA 225
                |...|..   |..:.:.|.::|||.....|           |:.   ..:|.|.: .:.|.
Zfish   140 YPGRHLTVLGG---FVDQVVGTGMLVLCILAIVDGRNIGAPRGVEPLAVGVVLLGISVSMGLNCG 201

  Fly   226 YSACCFVSMPYLNPARSLGPSF--VLNKWD-------SHWVYWF---GPLVGGMASGLVYEYIFN 278
            |.         |||||.|||..  .|..|.       .:| :|.   ||||||:...::|..:..
Zfish   202 YP---------LNPARDLGPRLFTALAGWGMEVFSTADYW-WWIPVAGPLVGGVVGAVIYFLLIE 256

  Fly   279 SRNRNLRHNKGSIDNDSSSIHSEDELNYDMDMEKPNKYQ 317
            ..:.|  ||    |........|::.:.:.|....:||:
Zfish   257 LHHSN--HN----DTPQEEPEEEEDEDEEEDSSLKDKYE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 60/253 (24%)
aqp9aNP_001028268.1 MIP 11..255 CDD:294134 61/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.