DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp1a.2

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001129154.1 Gene:aqp1a.2 / 559284 ZFINID:ZDB-GENE-100409-1 Length:269 Species:Danio rerio


Alignment Length:288 Identity:95/288 - (32%)
Similarity:148/288 - (51%) Gaps:37/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGAS-VSSVLLATALASGLAMATLTQCFL 118
            |..|:::..|||::::|.:...::|||  |.|:.:|...: .....:..|||.|||:|||.|...
Zfish     1 MARELKSWSFWRAVLAEFVGMTIFVFI--GIASAIGNKHNRYPDQEVKVALAFGLAIATLAQSLG 63

  Fly   119 HISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGV-----TVPGYQ--GNLQA 176
            ||||||:|||:||.|.|...||..||.|||.||..|.:..:.:::.|     |..|..  ||   
Zfish    64 HISGAHLNPAITLGLLVSCQISFFRAFMYIIAQMLGAVLASGIMFKVSPDPDTTLGLNMLGN--- 125

  Fly   177 AISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY---- 236
                  .:...:.|.:|...||.:|||...:||..:..:..|| .:||.:......|::.|    
Zfish   126 ------GVKVGQGFAIELFTTFQLVLCALATTDKNRTDVSGSAPLAIGLSVGLGHLVAISYTGCG 184

  Fly   237 LNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHN----KGSIDNDSSS 297
            :|||||.||:.||..:.:||:||..|:.||:|:.|:|:::...:...||..    ||:.|.|.|:
Zfish   185 INPARSFGPAVVLESFKNHWIYWIAPMCGGVAAALIYDFLLFPKREALRKRMNVLKGTADPDPSA 249

  Fly   298 IHSEDELNYDMDMEKPNKYQQSQGTYPR 325
            ..:         :.:|...:...|.:||
Zfish   250 TEA---------LIEPRSARSGSGQWPR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 82/227 (36%)
aqp1a.2NP_001129154.1 MIP 4..221 CDD:278651 82/227 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.