DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp8b

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001108382.2 Gene:aqp8b / 555598 ZFINID:ZDB-GENE-080220-47 Length:254 Species:Danio rerio


Alignment Length:252 Identity:71/252 - (28%)
Similarity:113/252 - (44%) Gaps:35/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KRSMQAEIRTLEFWRSIISECLASFM--YVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLT 114
            |...:.|:.....:..::..|:|..:  ..|::.|...  .:.::.....|..||..|||:|.:.
Zfish    13 KMVQETEMEEPGLFEQLVQPCMAELVGTAFFVLMGCLC--VIESAQEGHTLQAALVHGLALAVVI 75

  Fly   115 QCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVT----VPGYQGN-- 173
            .|.:.|||:|.||:.|:|:.:...:.......|:.:|..||:.||.:..|:|    ....||.  
Zfish    76 GCMVEISGSHFNPSFTIAVFLSGGLELKMVLPYLISQVSGGLLGAVMAKGMTSSEKYAQAQGAAF 140

  Fly   174 --LQAAISHSAALAAWERFGVEFILTFLVVLCYFVST------DPMKKFMGNSAASIGCAYS--- 227
              |||......||.|      |..:|.|..|...:|.      :.|..|:      :||...   
Zfish   141 TVLQADDHIMKALFA------EAAMTCLATLAVLLSAVNGKSKNHMFPFL------VGCTVMVNV 193

  Fly   228 -ACCFVSMPYLNPARSLGPSFVLNKWDSHWVYWFGPLVGGM-ASGLVYEYIFNSRNR 282
             |...||...|||.|:|||:.:.|.|..||:||.||:.||: |:.||..::.::..|
Zfish   194 LAGANVSGACLNPVRALGPAVLTNYWTHHWIYWVGPITGGLIAAALVRLFLGDNDTR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 68/235 (29%)
aqp8bNP_001108382.2 MIP 33..243 CDD:294134 68/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.