DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and mipb

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001018356.1 Gene:mipb / 553420 ZFINID:ZDB-GENE-050706-86 Length:263 Species:Danio rerio


Alignment Length:247 Identity:93/247 - (37%)
Similarity:124/247 - (50%) Gaps:23/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISG 122
            |.|::.|||::.:|...:..:||...|||.....|   ...:..|||..|.|.|||.|...||||
Zfish     3 EFRSMMFWRAVFAEFFGTMFFVFFGMGAALRWTTG---PYHVFHTALCFGFAAATLIQSIGHISG 64

  Fly   123 AHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQG-----NLQAAISHSA 182
            .|||||||.|..|...:|..||..||.|||.|.:||||.|||||....:|     .||..:|...
Zfish    65 GHINPAVTFAYLVGSQMSVFRAFFYICAQCLGAMAGAAALYGVTPNNMRGTMALNTLQPGMSLGM 129

  Fly   183 ALAAWERFGVEFILTFLVVLCYFVSTDPMKK-FMGNSAASIGCAYSACCFVSMPY----LNPARS 242
            |..      ||..||..:|:|.|..||..:. .:|::|.|||.:.:....:.|.|    :|||||
Zfish   130 ATT------VEVFLTMQLVVCVFAVTDERRNGRLGSAALSIGFSVTMGHLMGMYYTGAGMNPARS 188

  Fly   243 LGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHN----KGS 290
            ..|:.:...:.:|||||.||::|.....:.|::....|.|.....    |||
Zfish   189 FAPAVITRNFINHWVYWVGPMIGAAMGAIFYDFFLFPRMRGFSERLATLKGS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 87/224 (39%)
mipbNP_001018356.1 MIP 3..219 CDD:294134 87/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.