DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp3

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001016845.1 Gene:aqp3 / 549599 XenbaseID:XB-GENE-488014 Length:294 Species:Xenopus tropicalis


Alignment Length:241 Identity:69/241 - (28%)
Similarity:100/241 - (41%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPAVT 130
            |..:||||.:.:.|...||:.|.|.:........|...||.|.|:.........:||.|:|||||
 Frog    23 RQALSECLGTLILVMFGCGSVAQVVLSKGSHGQFLTVNLAFGFAVMLGILISGQVSGGHLNPAVT 87

  Fly   131 LALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPG--YQGNLQAAIS------------HS 181
            .|||::.....|:..:|..||..|...||.::||:....  :.||.|..:.            .|
 Frog    88 FALCIMAREPWIKFPIYSFAQTLGAFLGAGIIYGLYYDAIWFFGNDQLFVMGENGTAGIFTTFPS 152

  Fly   182 AALAAWERFGVEFILTFLVVLCYFVSTDPMKKFM--GNSAASIGCAY----SACCFVSMPYLNPA 240
            ..|.....|..:||.|..:::|.....||....:  |..|.::|...    ::..|.|...:|||
 Frog   153 EHLTLINGFFDQFIGTAALIVCVLAIVDPNNNPIPRGLEAFTVGFVVLVIGTSMGFNSGYAVNPA 217

  Fly   241 RSLGPSFV--LNKWDSHWVYWFG----------PLVGGMASGLVYE 274
            |..||...  |..|.:. |:|.|          ||:|.....|||:
 Frog   218 RDFGPRLFTSLAGWGTE-VFWAGNQWWWVPIVSPLLGAFTGVLVYQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 67/238 (28%)
aqp3NP_001016845.1 MIP 24..264 CDD:238204 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.