DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp2

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001015749.1 Gene:aqp2 / 548466 XenbaseID:XB-GENE-481401 Length:273 Species:Xenopus tropicalis


Alignment Length:275 Identity:101/275 - (36%)
Similarity:150/275 - (54%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVS-----SVLLATALASGLAMATLT 114
            |:.||.:|.|.|::.:|.||:.::||:        |:|:::|     ..:|..:||.|||::||.
 Frog     1 MRNEICSLAFVRAVFAEFLATMIFVFL--------GMGSALSWKPSLPNVLQISLAFGLAISTLV 57

  Fly   115 QCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAIS 179
            |.|.||||||||||||:|..:...||.:||..||.||..|.|||||::..:.....:|||  ||:
 Frog    58 QAFGHISGAHINPAVTIAFLIGCHISFLRALFYIIAQLVGAIAGAAIVSAIAPLDARGNL--AIN 120

  Fly   180 HSAALAAWERFGVEFILTFLVVLCYFVSTDPMKK-FMGNSAASIGCA---------YSACCFVSM 234
            .....:..:...||..|||.:|||.|.|||..:. .:|:.|.|||.:         |...|    
 Frog   121 EVTNGSPGQACAVELFLTFQLVLCVFASTDSRRSDNVGSPAISIGLSVTVGHLLGIYLTGC---- 181

  Fly   235 PYLNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHN----KGSIDNDS 295
             .:|||||.||:.:...:..|||:|.||||||:.:.|.|.|||....::|...    ||:...|.
 Frog   182 -SMNPARSFGPAAITGIFTDHWVFWIGPLVGGILASLFYNYIFFPHKKSLSDRLAILKGTYKPDE 245

  Fly   296 SSIHSEDELNYDMDM 310
            ...:.:::....:::
 Frog   246 PWDNKQEQKRQSVEL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 92/229 (40%)
aqp2NP_001015749.1 MIP 4..219 CDD:333943 92/229 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.