DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001005829.1 Gene:aqp1 / 448309 XenbaseID:XB-GENE-1217296 Length:274 Species:Xenopus tropicalis


Alignment Length:278 Identity:96/278 - (34%)
Similarity:152/278 - (54%) Gaps:38/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGV--GVGASVSSV---------LLATALASGL 108
            |.:|::...|||::|:|.||..::|||..|||.||  .:.|..::.         ::..:||.||
 Frog     1 MASELKKKAFWRAVIAEFLAMILFVFISIGAALGVQYPIPADAANATNTDTRQQDIVKVSLAFGL 65

  Fly   109 AMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVP----- 168
            |:|||.|...||||||:||||||...:...||.::|.|||.|||.|.:.|.|:|.|:|..     
 Frog    66 AIATLAQSVGHISGAHLNPAVTLGCLLSCQISILKALMYIIAQCLGAVVGTAILSGITTQISNNS 130

  Fly   169 -GYQGNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCF 231
             |..| |...:|....|      |||.::||.:|||....||..:..:..|| .:||.:.:....
 Frog   131 LGLNG-LSNGVSQGQGL------GVEIMVTFQLVLCVVAITDRRRNDVSGSAPLAIGLSVALGHL 188

  Fly   232 VSMPY----LNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSID 292
            :::.|    :|||||.|.:.|..::.:||::|.||::||.|:.::|::|.:.|..:|        
 Frog   189 IAIDYTGCGMNPARSFGSAVVAKQFANHWIFWVGPMIGGAAAAIIYDFILSPRTSDL-------- 245

  Fly   293 NDSSSIHSEDEL-NYDMD 309
            .|...:.:..:: .|::|
 Frog   246 TDRMKVWTNGQVEEYELD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 88/236 (37%)
aqp1NP_001005829.1 MIP 4..234 CDD:333943 88/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.