DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp8a.1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001004661.1 Gene:aqp8a.1 / 447923 ZFINID:ZDB-GENE-040912-106 Length:260 Species:Danio rerio


Alignment Length:250 Identity:73/250 - (29%)
Similarity:112/250 - (44%) Gaps:44/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QAEIRTLEFWRSIISECLA----SFMYVFIVCGAAAG-VGVGASVSSVLLATALASGLAMATLTQ 115
            |.:.:.|.|:...|..|||    ||:::|:.|.:..| ||:..|:.     .|||.|||:|....
Zfish    23 QNQPKKLPFFEHYIQPCLAEVVGSFLFMFVGCVSVMGNVGISGSIQ-----PALAHGLALAIAIA 82

  Fly   116 CFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISH 180
            .|..|||.|.||||::.:.::..:..|....||.:|..||:..|:|...||......|...|..:
Zfish    83 IFGEISGGHFNPAVSVCVYLIGGMEVILLVPYIISQMLGGVIAASLAKAVTTNDAFSNATGAAFN 147

  Fly   181 SAALAAWERFG----VEFILT-FLVVLCYFVSTDPMKKFMGNSAASI---------------GCA 225
              |:.:.:..|    .|.|:| ||.::   ||   |....|.:.:.:               |..
Zfish   148 --AIPSSDGIGAATMAEMIMTLFLTIV---VS---MGAVNGRTKSQLAPFCIGLTVTANILAGGG 204

  Fly   226 YSACCFVSMPYLNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSR 280
            .|..|      :||||:.||:.|...|..||:||.|||.|.:.:..:...:...:
Zfish   205 ISGAC------MNPARAFGPAVVSGHWTHHWIYWVGPLTGALVTVSIVRLVMGDK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 72/239 (30%)
aqp8a.1NP_001004661.1 MIP 39..249 CDD:294134 69/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.