DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp4

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001345242.1 Gene:aqp4 / 445293 ZFINID:ZDB-GENE-040724-152 Length:346 Species:Danio rerio


Alignment Length:246 Identity:93/246 - (37%)
Similarity:140/246 - (56%) Gaps:20/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NNRLSSTLQAPKRSMQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSV----LLA 101
            ||.:.:..:.        :.|.||||::..|.||  |.:|::....:.:..||...:.    |:.
Zfish    20 NNSIMAAFKG--------VWTQEFWRAVSGEFLA--MIIFVLLSLGSTINWGAKQENPPPADLVL 74

  Fly   102 TALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVT 166
            .:|..||::|||.|||.||||||||||||:|:...|.:|..:...|:.|||.|.:.|||:|||||
Zfish    75 ISLCFGLSIATLVQCFGHISGAHINPAVTVAMVATRKLSLAKGVFYLLAQCLGAVVGAAILYGVT 139

  Fly   167 VPGYQGNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKK-FMGNSAASIGCAYSACC 230
            ....:|.: ...|.:..::|.....:|.|:||.:|...|.:.||.:. ..|::|.:||.:.....
Zfish   140 PASVRGGM-GVTSVNEEISAGHAIVIELIITFELVFTVFATCDPKRNDLKGSAALAIGLSVCIGH 203

  Fly   231 FVSMPY----LNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIF 277
            ..::||    :|||||.||:.::.||..|||||.|||:||:.:..||||:|
Zfish   204 LFAIPYTGASMNPARSFGPAVIMVKWQDHWVYWVGPLIGGILAAAVYEYLF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 86/223 (39%)
aqp4NP_001345242.1 MIP 32..250 CDD:278651 86/220 (39%)
DUF737 <290..>345 CDD:310129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.