DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and mipa

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001003534.1 Gene:mipa / 445140 ZFINID:ZDB-GENE-040801-41 Length:263 Species:Danio rerio


Alignment Length:274 Identity:94/274 - (34%)
Similarity:134/274 - (48%) Gaps:33/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISG 122
            |.|::.|||::.:|...:..:||...|||.....|   ...:|..|...|||.||..|...||||
Zfish     3 EFRSMSFWRAVFAEFYGTMFFVFFGLGAALRWTTG---PHNVLQVAFCFGLAAATFIQSIGHISG 64

  Fly   123 AHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGN-----LQAAISHSA 182
            .|||||||.|..:...:|..||..||.|||.|.:||||:|||||....:||     ||..||...
Zfish    65 GHINPAVTFAYLIGSQMSLFRAFFYICAQCLGALAGAAVLYGVTPTNMRGNLALNTLQPGISMGM 129

  Fly   183 ALAAWERFGVEFILTFLVVLCYFVSTDPMKK-FMGNSAASIGCAYSACCFVSMPY----LNPARS 242
            |..      :|..||..:|:|.|..||..:. .:|::|.|||.:......:.|.|    :|||||
Zfish   130 ATT------IEIFLTLQLVVCVFAVTDERRNGRLGSAALSIGFSVLVGHLLGMYYTGAGMNPARS 188

  Fly   243 LGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSIDNDSSSIHSEDELNYD 307
            ..|:.:...:.:|||||.||::|.....|:|:::...|.|.|......:..:..:          
Zfish   189 FAPAVLYRNFINHWVYWVGPMIGAAMGALLYDFMLFPRVRGLSERLAVLKGNKPT---------- 243

  Fly   308 MDMEKPNKYQQSQG 321
                :|...|:::|
Zfish   244 ----EPEAQQETRG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 87/224 (39%)
mipaNP_001003534.1 MIP 3..219 CDD:278651 87/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.