DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and MIP

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_036196.1 Gene:MIP / 4284 HGNCID:7103 Length:263 Species:Homo sapiens


Alignment Length:266 Identity:97/266 - (36%)
Similarity:142/266 - (53%) Gaps:27/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSV-----LLATALASGLAMATLTQCF 117
            |:|:..|||:|.:|..|:..|||.        |:|:|:...     :|..|:|.|||:|||.|..
Human     3 ELRSASFWRAIFAEFFATLFYVFF--------GLGSSLRWAPGPLHVLQVAMAFGLALATLVQSV 59

  Fly   118 LHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSA 182
            .||||||:|||||.|..|...:|.:||..|:.||..|.:||||:||.||.|..:|||.....| .
Human    60 GHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLH-P 123

  Fly   183 ALAAWERFGVEFILTFLVVLCYFVSTDPMKK-FMGNSAASIGCAYSACCFVSMPY----LNPARS 242
            |::..:...||..||...|||.|.:.|..:. .:|:.|.::|.:.:......|.|    :|||||
Human   124 AVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARS 188

  Fly   243 LGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRN-------LRHNKGSIDNDSSSIHS 300
            ..|:.:...:.:|||||.||::||....|:|:::...|.::       |:..|..:.|....:..
Human   189 FAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTG 253

  Fly   301 ED-ELN 305
            |. |||
Human   254 EPVELN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 88/224 (39%)
MIPNP_036196.1 MIP 3..219 CDD:333943 88/224 (39%)
NPA 1 68..70 1/1 (100%)
NPA 2 184..186 1/1 (100%)
Interaction with CALM. /evidence=ECO:0000250 227..237 0/9 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.