DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Eglp3

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster


Alignment Length:234 Identity:69/234 - (29%)
Similarity:107/234 - (45%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIIS----ECLASFMYVFIVCGAAAGVGVGASVSSVL----LATALASGLAMATLTQCFLHISG 122
            ||.|:    |..|:.::|||.|       :|...:.:.    ..:.|..|||:....|||..:||
  Fly    24 RSAIACFFGELAATAVFVFIAC-------MGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSG 81

  Fly   123 AHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISH------- 180
            ||:|||:|||..:..:|..|||..|..||..|.:.|    ||:.|....||....:.:       
  Fly    82 AHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIG----YGLLVAVLPGNSIKGVDNPSGVCVT 142

  Fly   181 --SAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNS-----AASIGCAYSACCFVSMPYLN 238
              :..::..:...:||::|..:|:......||....:.:|     ..::.|........:...:|
  Fly   143 ILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMN 207

  Fly   239 PARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIF 277
            |.|||||:...:.|..||:||.||||.|..:.|:|...|
  Fly   208 PTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 67/228 (29%)
Eglp3NP_611812.2 MIP 30..244 CDD:294134 65/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.