DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Eglp2

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster


Alignment Length:267 Identity:78/267 - (29%)
Similarity:121/267 - (45%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVL----LATALASGLAMATLTQCFLHI 120
            |.|:...::::|.:|:.|.:|:.|       :|:..:||.    ..:||..|..:....|||..:
  Fly    41 RQLDSITTVLAEMIATAMLMFLGC-------MGSVENSVFTNSDFQSALNFGFVVLICIQCFGCV 98

  Fly   121 SGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAI------- 178
            .|||:|||||||..|...||...|..|..||..|...|..||..| :|      ::||       
  Fly    99 CGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAV-LP------ESAIYSAENPN 156

  Fly   179 -----SHSAALAAWERFGVEFILT-FLVVLCYFVSTDPMKKFMGNS-----AASIGCAYSACCFV 232
                 |.::.|..|:...|||::| .|:.:|..| .||......:|     ..:|.|.......:
  Fly   157 GVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGV-WDPRNATKQDSLPVRFGLAIACLSLTAGQL 220

  Fly   233 SMPYLNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSIDNDSSS 297
            :...:||.||..|:.....||.||:||.||:...:.:.::|::.|   .|.|..::......|:.
  Fly   221 TGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAF---RRELEESEVDETTMSTK 282

  Fly   298 IHSEDEL 304
            ..||.||
  Fly   283 RTSEAEL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 69/234 (29%)
Eglp2NP_788433.2 MIP 41..261 CDD:294134 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.