DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Eglp1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_611810.1 Gene:Eglp1 / 37736 FlyBaseID:FBgn0034882 Length:238 Species:Drosophila melanogaster


Alignment Length:228 Identity:47/228 - (20%)
Similarity:95/228 - (41%) Gaps:37/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPAVTLALC 134
            :|..|:.:.:.:.|   .|........|..|..::..||.:..:...|..:||||.||.::::..
  Fly    13 TEFSATALLILLGC---MGDSTNQGGESKFLVASVHYGLTVMVVMHVFGFVSGAHSNPCISISCY 74

  Fly   135 VVRSISPIRAAMYITAQCGGGIAGAALLYGV--------TVPGYQGNLQAAISHSAALAAWERFG 191
            ::..|:.....||:..|..|...|..||..:        :.||.     ..:.....|:.::...
  Fly    75 LMGYIALEVMMMYVVCQMAGAFLGYFLLMQLLPKELVDKSKPGI-----CLVQPMDTLSTYQVVI 134

  Fly   192 VEFILTFLVVLCYFVSTDPMK-KFMGNSAASIGCAYSACCFVSMPY----LNPARSLGPSFVLNK 251
            :|.:||.::||.:....|... :|:.:.|..:|....||.|..:..    :|||::|.|:     
  Fly   135 IECLLTAVLVLGWCSLWDVRNGRFLDSVAIRMGLLVIACSFAGIQLTGASMNPAKTLVPA----- 194

  Fly   252 WDSHWVYWFGP------LVGGMASGLVYEYIFN 278
                 :::..|      |.|.:.:.::..:::|
  Fly   195 -----IFYGSPNSVLMQLTGQILAAIMVPFVWN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 46/221 (21%)
Eglp1NP_611810.1 MIP 13..223 CDD:294134 47/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.