DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and AQP7

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001161.1 Gene:AQP7 / 364 HGNCID:640 Length:342 Species:Homo sapiens


Alignment Length:290 Identity:74/290 - (25%)
Similarity:108/290 - (37%) Gaps:76/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GHGVNNRLSSTLQAPKRSMQAEIRTLEFWRSIISECLASFM--YVFIVCGAAAGVGVGASVSSVL 99
            ||..:.|.|..:   ..|:.|:|:.: ..|.::.|.||.||  ||.:|      .|:|:....||
Human     6 GHRRSTRGSKMV---SWSVIAKIQEI-LQRKMVREFLAEFMSTYVMMV------FGLGSVAHMVL 60

  Fly   100 -------LATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIA 157
                   |...|..|..:.........|||||:|.|||.|.|.:..:...:..:|:..|..|...
Human    61 NKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFL 125

  Fly   158 GAALLYGV---TVPGYQGNLQAAISHSAALAA------------WERFGVEFILTFLVVLCYFVS 207
            .||.:|.:   .:..:.|. |..::...|.|.            |..|..|..||.::.||.|..
Human   126 AAATIYSLFYTAILHFSGG-QLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAI 189

  Fly   208 TDPMKK--FMGNSAASIG-------------CAYSACCFVSMPYLNPARSLGP---SFVL----- 249
            ||....  ..|..|..||             ..|:         :||:|.|.|   :|:.     
Human   190 TDQENNPALPGTEALVIGILVVIIGVSLGMNTGYA---------INPSRDLPPRIFTFIAGWGKQ 245

  Fly   250 ------NKWDSHWVYWFGPLVGGMASGLVY 273
                  |.|   ||....||:|....|::|
Human   246 VFSNGENWW---WVPVVAPLLGAYLGGIIY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 67/267 (25%)
AQP7NP_001161.1 MIP 31..280 CDD:412216 67/261 (26%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 94..96 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 226..228 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.