DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and AQP6

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001643.2 Gene:AQP6 / 363 HGNCID:639 Length:282 Species:Homo sapiens


Alignment Length:258 Identity:86/258 - (33%)
Similarity:130/258 - (50%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GGHGVNNRLSSTLQAPKRSMQAEIRTLEFW----RSIISECLASFMYVFIVCGAAAGVGVGA--- 93
            ||.|..:.|:..|                |    |::.:|.||:.:|||.        |||:   
Human     7 GGRGWASMLACRL----------------WKAISRALFAEFLATGLYVFF--------GVGSVMR 47

  Fly    94 ---SVSSVLLATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGG 155
               ::.|| |..|:...|..|...|.....||||.|||||||..|...||..||..|:.||..|.
Human    48 WPTALPSV-LQIAITFNLVTAMAVQVTWKASGAHANPAVTLAFLVGSHISLPRAVAYVAAQLVGA 111

  Fly   156 IAGAALLYGVTVPGYQGNLQAAISHSA---ALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGN 217
            ..|||||||| :|   |:::..:..:.   :::..:...||.:||..:|||.|.||| .::..|:
Human   112 TVGAALLYGV-MP---GDIRETLGINVVRNSVSTGQAVAVELLLTLQLVLCVFASTD-SRQTSGS 171

  Fly   218 SAASIGCAYSACCFVSMPY----LNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYI 276
            .|..||.:.:....:.:.:    :|||||.||:.::.|:..|||:|.|||:|.:.:.|:|.::
Human   172 PATMIGISVALGHLIGIHFTGCSMNPARSFGPAIIIGKFTVHWVFWVGPLMGALLASLIYNFV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 80/231 (35%)
AQP6NP_001643.2 MIP 25..231 CDD:294134 79/219 (36%)
NPA 1 82..84 1/1 (100%)
NPA 2 196..198 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.