DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Drip

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster


Alignment Length:220 Identity:81/220 - (36%)
Similarity:122/220 - (55%) Gaps:14/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINP 127
            :.||.::.|.:.:|..:|        ||||::.|..:...|...||.:||:.|...|:||.||||
  Fly    21 KIWRMLLGELVGTFFLIF--------VGVGSTTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINP 77

  Fly   128 AVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAALAAWERFGV 192
            ||||...:|..||.::||.||..||.|.|||||:: .|.:.|..|......|...:|...:...:
  Fly    78 AVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI-KVALDGVAGGDLGVSSFDPSLNCAQAVLI 141

  Fly   193 EFILTFLVVLCYFVSTDPMKK-FMGNSAASIGCAYSA---CCF-VSMPYLNPARSLGPSFVLNKW 252
            |.::||::|......:||.:: ..|::..::|.|.:|   |.. :|...:|||||.||:.|...|
  Fly   142 EALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVW 206

  Fly   253 DSHWVYWFGPLVGGMASGLVYEYIF 277
            ..|||||.||:.||:.:|::|..||
  Fly   207 TYHWVYWVGPIAGGLLAGIIYRLIF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 78/214 (36%)
DripNP_001260893.1 MIP 23..227 CDD:294134 78/212 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.