DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and AQP4

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001304313.1 Gene:AQP4 / 361 HGNCID:637 Length:352 Species:Homo sapiens


Alignment Length:291 Identity:98/291 - (33%)
Similarity:153/291 - (52%) Gaps:34/291 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TLEFWRSIISECLASFMYVFIVCGAA---AGVGVGASVSSVLLATALASGLAMATLTQCFLHISG 122
            |..||:::.:|.||..::|.:..|:.   .|......|..||:  :|..||::||:.|||.||||
Human    31 TQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLI--SLCFGLSIATMVQCFGHISG 93

  Fly   123 AHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAALAAW 187
            .|||||||:|:...|.||..::..||.|||.|.|.||.:||.||.|...|.|...:.| ..|.|.
Human    94 GHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVH-GNLTAG 157

  Fly   188 ERFGVEFILTFLVVLCYFVSTDPMK-KFMGNSAASIGCAYSACCFVSMPY----LNPARSLGPSF 247
            ....||.|:||.:|...|.|.|..: ...|:.|.:||.:.:.....::.|    :|||||.||:.
Human   158 HGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAV 222

  Fly   248 VLNKWDSHWVYWFGPLVGGMASGLVYEYIF-----------NSRNRNLRHNKGS---IDNDSSSI 298
            ::..|::||:||.||::|.:.:|.:|||:|           .:.::..:..|||   ::::.|.:
Human   223 IMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQV 287

  Fly   299 HSED---------ELNYDMDMEKPNKYQQSQ 320
            .::|         .::.|...||..|.|..:
Human   288 ETDDLILKPGVVHVIDVDRGEEKKGKDQSGE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 84/219 (38%)
AQP4NP_001304313.1 MIP 31..248 CDD:278651 84/219 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.