DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and AQP3

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_004916.1 Gene:AQP3 / 360 HGNCID:636 Length:292 Species:Homo sapiens


Alignment Length:266 Identity:72/266 - (27%)
Similarity:106/266 - (39%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPAVT 130
            |..::|||.:.:.|...||:.|.|.:........|...||.|.|:.........:||||:|||||
Human    23 RQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILIAGQVSGAHLNPAVT 87

  Fly   131 LALCVVRSISPIRAAMYITAQCGGGIAGAALLYG-------------VTVPGYQGNLQAAISH-S 181
            .|:|.:.....|:..:|..||..|...||.:::|             :.|.|..|......:: |
Human    88 FAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGPNGTAGIFATYPS 152

  Fly   182 AALAAWERFGVEFILTFLVVLCYFVSTDPMKKFM--GNSAASIGCAY----SACCFVSMPYLNPA 240
            ..|.....|..:||.|..:::|.....||....:  |..|.::|...    ::..|.|...:|||
Human   153 GHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPA 217

  Fly   241 RSLGPSF--VLNKWDS-------HWVYW---FGPLVGGMASGLVYEYIF-----------NSRNR 282
            |..||..  .|..|.|       || :|   ..||:|.:|...||:.:.           ...|.
Human   218 RDFGPRLFTALAGWGSAVFTTGQHW-WWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENV 281

  Fly   283 NLRHNK 288
            .|.|.|
Human   282 KLAHVK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 66/238 (28%)
AQP3NP_004916.1 MIP 23..264 CDD:238204 68/241 (28%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.