DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and AQP8

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_011544124.1 Gene:AQP8 / 343 HGNCID:642 Length:262 Species:Homo sapiens


Alignment Length:238 Identity:75/238 - (31%)
Similarity:110/238 - (46%) Gaps:35/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAHINPA 128
            |.:..:.|.|.|.:::||.|.:....|....:....||..||.||.:|||.    :|||.|.|||
Human    35 FVQPCLVELLGSALFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLG----NISGGHFNPA 95

  Fly   129 VTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAI--------SHSAALA 185
            |:||..::..::.:....|..:|..||:.||||...|:......|...|.        ..:.||.
Human    96 VSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALV 160

  Fly   186 AWERFGVEFILTFLVVLCYFV------STDPMKKFMGNSAASIGCAYSACCFVSMPY----LNPA 240
            |      |.|||.|:.|...:      :..|:..|      |||.|.:.......|.    :|||
Human   161 A------EIILTTLLALAVCMGAINEKTKGPLAPF------SIGFAVTVDILAGGPVSGGCMNPA 213

  Fly   241 RSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYE-YIFNSRNR 282
            |:.||:.|.|.|:.||:||.|||:.|:..||:.. :|.:.:.|
Human   214 RAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDGKTR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 73/226 (32%)
AQP8XP_011544124.1 MIP 39..232 CDD:294134 64/208 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.