DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp1a.1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_996942.1 Gene:aqp1a.1 / 335821 ZFINID:ZDB-GENE-030131-7764 Length:260 Species:Danio rerio


Alignment Length:230 Identity:80/230 - (34%)
Similarity:129/230 - (56%) Gaps:22/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISG 122
            |:::..|||::::|.|...:::|:...||.| ..........:..|||.||::|||.|...||||
Zfish     3 ELKSKAFWRAVLAELLGMTLFIFLSITAAVG-NTNTQNPDQEIKVALAFGLSIATLAQSLGHISG 66

  Fly   123 AHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAALAAW 187
            ||:||||||.|.....||.:||.|||.||..|....:|::.||:    :|:..........::|.
Zfish    67 AHLNPAVTLGLLASCQISLLRAVMYILAQMIGATVASAIVLGVS----KGDALGLNQIHTDISAG 127

  Fly   188 ERFGVEFILTFLVVLCYFVSTDPMKKFMGNSA-ASIG---C-------AYSACCFVSMPYLNPAR 241
            :..|:|.:.||.:|||...:||..::.:..|| .:||   |       :::.|      .:||||
Zfish   128 QGVGIELLATFQLVLCVLATTDKRRRDVSGSAPLAIGLSVCLGHLTAISFTGC------GINPAR 186

  Fly   242 SLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYI 276
            :.||:.:...:.:|||||.||:.||:|:.|:|:::
Zfish   187 TFGPAMIRLDFANHWVYWVGPMCGGVAAALIYDFL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 79/225 (35%)
aqp1a.1NP_996942.1 MIP 3..218 CDD:278651 79/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.