DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp7

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_005161068.1 Gene:aqp7 / 334529 ZFINID:ZDB-GENE-030131-6461 Length:310 Species:Danio rerio


Alignment Length:276 Identity:63/276 - (22%)
Similarity:108/276 - (39%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APKRSMQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLT 114
            ||......:|:. |:.|..::|.|.:|:.:....|..|.|..|.......|:..:..|||:|...
Zfish    11 APNVGSMLKIKN-EYIRVALAESLCTFIMMVFGLGTVAQVVTGEGYFGEYLSINIGFGLAVAMGV 74

  Fly   115 QCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLY---------------- 163
            .....:||||:|.||:..:||...:......:|:.||..|....|..::                
Zfish    75 HVGGKVSGAHMNAAVSFTMCVFGRLRWKMLPLYVFAQFLGSFLAAGTIFSLYYAFVLLFIDAINH 139

  Fly   164 ----GVTVPGYQGNLQAAISHSAA-LAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSAASIG 223
                .:||.|.:.......::.|. ::.:..|..:...|.|::||....:|...:.:.:...::|
Zfish   140 FCGGNLTVSGPKATAGIFATYPAPYISVYTGFFDQVAGTGLLLLCLMALSDQRNQPLVSGGEAVG 204

  Fly   224 CAYSACCF-VSMP-----YLNPARSLGPS-FVL------------NKWDSHWVYWFGPLVGGMAS 269
            ........ |||.     .:||.|.|||. |.|            |.|  .||....|.:||:..
Zfish   205 VGLLVMLIGVSMGSNSGYAINPTRDLGPRLFTLMAGWGTEVFRAGNCW--WWVPLVAPFIGGVLG 267

  Fly   270 GLVYEYIFNSRNRNLR 285
            .|:|:.:....:.:|:
Zfish   268 ALIYKALVELHHPDLK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 59/254 (23%)
aqp7XP_005161068.1 MIP 7..275 CDD:294134 62/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.