DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp4

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_038952509.1 Gene:Aqp4 / 25293 RGDID:2143 Length:380 Species:Rattus norvegicus


Alignment Length:292 Identity:101/292 - (34%)
Similarity:155/292 - (53%) Gaps:36/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TLEFWRSIISECLASFMYVFIVCGAAAGVGVGAS-----VSSVLLATALASGLAMATLTQCFLHI 120
            |..||:::.:|.||  |.:|::....:.:..|.|     |..||:  :|..||::||:.|||.||
  Rat    72 TQAFWKAVTAEFLA--MLIFVLLSVGSTINWGGSENPLPVDMVLI--SLCFGLSIATMVQCFGHI 132

  Fly   121 SGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAALA 185
            ||.|||||||:|:...|.||..::..||||||.|.|.||.:||.||.|...|.|.....| ..|.
  Rat   133 SGGHINPAVTVAMVCTRKISIAKSVFYITAQCLGAIIGAGILYLVTPPSVVGGLGVTTVH-GNLT 196

  Fly   186 AWERFGVEFILTFLVVLCYFVSTDPMK-KFMGNSAASIGCAYSACCFVSMPY----LNPARSLGP 245
            |.....||.|:||.:|...|.|.|..: ...|:.|.:||.:.:.....::.|    :|||||.||
  Rat   197 AGHGLLVELIITFQLVFTIFASCDSKRTDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGP 261

  Fly   246 SFVLNKWDSHWVYWFGPLVGGMASGLVYEYIF-----------NSRNRNLRHNKGS---IDNDSS 296
            :.::..|::||:||.||::|.:.:|.:|||:|           .:.::..:..|||   ::::.|
  Rat   262 AVIMGNWENHWIYWVGPIIGAVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRS 326

  Fly   297 SIHSEDEL-------NYDMDMEKPNKYQQSQG 321
            .:.:||.:       ..|:|.....|.:.|.|
  Rat   327 QVETEDLILKPGVVHVIDIDRGDEKKGKDSSG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 86/221 (39%)
Aqp4XP_038952509.1 MIP 72..289 CDD:395174 86/221 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.