DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp5

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_036911.1 Gene:Aqp5 / 25241 RGDID:2144 Length:265 Species:Rattus norvegicus


Alignment Length:244 Identity:90/244 - (36%)
Similarity:144/244 - (59%) Gaps:13/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLH 119
            |:.|:.:|.|::::.:|.||:.::||...|:|.   ...|....:|..::|.|||:.||.|....
  Rat     1 MKKEVCSLAFFKAVFAEFLATLIFVFFGLGSAL---KWPSALPTILQISIAFGLAIGTLAQALGP 62

  Fly   120 ISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQA-AISHSAA 183
            :||.|||||:||||.:...||.:||..|:.||..|.||||.:||.:.....:|||.. |::::. 
  Rat    63 VSGGHINPAITLALLIGNQISLLRAVFYVAAQLVGAIAGAGILYWLAPLNARGNLAVNALNNNT- 126

  Fly   184 LAAWERFGVEFILTFLVVLCYFVSTDPMKKF-MGNSAASIGCAYSACCFVSMPY----LNPARSL 243
             ...:...||.||||.:.||.|.|||..:.. :|:.|.|||.:.:....|.:.:    :|||||.
  Rat   127 -TPGKAMVVELILTFQLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSF 190

  Fly   244 GPSFVLNKWD-SHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSI 291
            ||:.|:|::. ||||:|.||:||.|.:.::|.|:....:.:| |::.::
  Rat   191 GPAVVMNRFSPSHWVFWVGPIVGAMLAAILYFYLLFPSSLSL-HDRVAV 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 85/221 (38%)
Aqp5NP_036911.1 MIP 4..221 CDD:395174 85/221 (38%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 69..71 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 185..187 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.